PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_04689.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 143aa    MW: 15757.4 Da    PI: 5.2047
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_04689.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.43.1e-132887463
                             XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1  4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                             +++ +r+ +NRe+ArrsR RK++ ++ L+  + +L++ N++    l+  ++++ k ++e+
  Rsa1.0_04689.1_g00002.1 28 DRKRKRMLSNRESARRSRMRKQKHVDDLTAQINQLSNDNRQILTSLSVTTQLYMKIQAEN 87
                             7899************************************99999998888888877776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.0E-172589IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.8E-102672No hitNo description
PROSITE profilePS5021710.1282790IPR004827Basic-leucine zipper domain
PfamPF001702.6E-102885IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.91E-122982No hitNo description
CDDcd147021.01E-203081No hitNo description
PROSITE patternPS0003603247IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MASSSTTYRS SSSSDGGNPS GPVVAVDDRK RKRMLSNRES ARRSRMRKQK HVDDLTAQIN  60
QLSNDNRQIL TSLSVTTQLY MKIQAENSIL TAQMTELSTR LESLNEIVDL VTTTNNGGGV  120
DQIDGCGFDD RTVGINCDGY YDD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12849RKRKRMLSNRESARRSRMRKQK
24148RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2325500.0AC232550.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH011J16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013612816.11e-84PREDICTED: ocs element-binding factor 1-like
TrEMBLA0A078ITE31e-84A0A078ITE3_BRANA; BnaC09g09660D protein
TrEMBLA0A0D3E3C21e-84A0A0D3E3C2_BRAOL; Uncharacterized protein
STRINGBra037235.1-P8e-83(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50128154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18160.12e-74basic leucine-zipper 2